PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10010045m
Common NameCARUB_v10010045mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 262aa    MW: 29937.6 Da    PI: 5.8369
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10010045mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.41e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd++lv +++++G  +W++ + + g++R +k+c++rw++yl
  Carubv10010045m 14 RGEWTAEEDQKLVAYINEHGICDWRSLPIRAGLHRYGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding569.2e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T++E+e +++ ++ lG++ W++Ia+ m+ +Rt++++k++w++ 
  Carubv10010045m  67 RGKFTPQEEEDIINFHAVLGNR-WAAIAKLMP-NRTDNDIKNHWNSC 111
                      89********************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.37961IPR017930Myb domain
SuperFamilySSF466898.39E-2911108IPR009057Homeodomain-like
SMARTSM007176.8E-121363IPR001005SANT/Myb domain
PfamPF002493.4E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-211568IPR009057Homeodomain-like
CDDcd001671.53E-81661No hitNo description
PROSITE profilePS5129425.26362116IPR017930Myb domain
SMARTSM007172.5E-1566114IPR001005SANT/Myb domain
PfamPF002493.1E-1667111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2569116IPR009057Homeodomain-like
CDDcd001678.56E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MGRTTWFDVD GMKRGEWTAE EDQKLVAYIN EHGICDWRSL PIRAGLHRYG KSCRLRWLNY  60
LRPGIKRGKF TPQEEEDIIN FHAVLGNRWA AIAKLMPNRT DNDIKNHWNS CLKKRLSRKG  120
IDPMTHEPII KHLTIKTTDE DCGSSSTTTS PSTGSSPSSA PARLLNKLAA GISSRQHSLD  180
RIKYILSNQM IISSDQVEEE RDQSDMDQKI AGGEEDDAQI WTEEEVRRLM ETDVMEYDVT  240
SYDSIMYEST HMLDHLSFDS V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0651660.0AY065166.1 Arabidopsis thaliana Putative MYB47 transcription factor (F6a14.18) mRNA, complete cds.
GenBankAY1145790.0AY114579.1 Arabidopsis thaliana Putative MYB47 transcription factor (At1g18710) mRNA, complete cds.
GenBankAY5195560.0AY519556.1 Arabidopsis thaliana MYB transcription factor (At1g18710) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006304114.10.0hypothetical protein CARUB_v10010045mg
TrEMBLR0GM660.0R0GM66_9BRAS; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_10016911e-139(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18710.11e-136myb domain protein 47